RST Threat feed. IOC: qtkwtflflvdnypgfdllldaenmdlfdtxwopak-dot-offglen.uk.r.appspot.com

2020-11-14T00:00:00
ID RST:EF8399D2-598C-37FF-8E21-86B9EF77ED5B
Type rst
Reporter RST Threat Feed
Modified 2020-11-11T00:00:00

Description

Found qtkwtflflvdnypgfdllldaenmdlfdtxwopak-dot-offglen[.]uk.r.appspot.com in RST Threat Feed with score 54. First seen: 2020-11-11T03:00:00, Last seen: 2020-11-13T03:00:00. IOC tags: phishing. Domain has DNS A records: 172[.]217.168.180 https://rstcloud.net/