RST Threat feed. IOC: snowagainfearfreezesagainagainitfeelslikeiceisinmyhands.space

2020-11-04T00:00:00
ID RST:76B35876-F3A5-3E9F-98ED-752721D3CFF9
Type rst
Reporter RST Threat Feed
Modified 2020-01-08T00:00:00

Description

Found snowagainfearfreezesagainagainitfeelslikeiceisinmyhands[.]space in RST Threat Feed with score 10. First seen: 2020-01-08T03:00:00, Last seen: 2020-10-28T03:00:00. IOC tags: malware. IOC could be a False Positive (Domain not resolved. Whois records not found). https://rstcloud.net/